PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_183_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 329aa    MW: 35574.2 Da    PI: 7.8372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_183_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.78.5e-111154445
                                        S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
                     Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                                        W+ e d+ + +a + ++ +   +W++Ia+ ++ g++l+++k+++ 
  cra_locus_183_iso_3_len_1420_ver_3 11 WSREQDKAFENALATYPEDtadRWEKIAADVP-GKSLEEIKHHYE 54
                                        ********************************.**********96 PP

2Myb_DNA-binding41.82.5e-13121165347
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                         +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  cra_locus_183_iso_3_len_1420_ver_3 121 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 165
                                         6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.782666IPR017884SANT domain
SMARTSM007173.7E-8759IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-11965IPR009057Homeodomain-like
PfamPF002492.0E-81154IPR001005SANT/Myb domain
CDDcd001674.25E-91157No hitNo description
Gene3DG3DSA:1.10.10.601.9E-41154IPR009057Homeodomain-like
PROSITE profilePS5129417.581113170IPR017930Myb domain
SuperFamilySSF466891.5E-16116171IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17118168IPR006447Myb domain, plants
SMARTSM007173.2E-10118168IPR001005SANT/Myb domain
CDDcd001671.11E-9121166No hitNo description
PfamPF002493.1E-11121165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-10121164IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MTADESISSM WSREQDKAFE NALATYPEDT ADRWEKIAAD VPGKSLEEIK HHYELLVDDV  60
SRIESGTVPL PCYTTASDGS SSHAGDEGSG KKGGNFGHFN SDSNHGGKAS RSDQERRKGI  120
AWTEDEHRLF LLGLDKYGKG DWRSISRNFV VTRTPTQVAS HAQKYFIRLN SMNKDRRRSS  180
IHDITSVNTG DVSVPQGPIT GQTNGSAAGV SAVKSNKPPP QATAAAPGVG MYGTTIGQPV  240
GGPLVSAVGT PVNLPQQAHM AYHAPIPGPV VPGAPMNMGP MTYPMPHTSA HRXSMQQMRT  300
SARAYWCXLT YLIDLSKKIS DETVSFHLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1811751175RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070471.11e-179PREDICTED: transcription factor DIVARICATA
RefseqXP_011070472.11e-179PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068VFI40.0A0A068VFI4_COFCA; Uncharacterized protein
STRINGGLYMA07G28310.11e-163(Glycine max)